PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004502537.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family MIKC_MADS
Protein Properties Length: 181aa    MW: 20716.8 Da    PI: 9.3563
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004502537.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF93.97.2e-30959151
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                    krien+snrqvt+skR+ngilKKA+E+SvLCda+v++i+f+ +gk++ey+s
  XP_004502537.1  9 KRIENSSNRQVTYSKRKNGILKKAKEISVLCDAQVSLILFGASGKMHEYIS 59
                    79***********************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.4E-38160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.651161IPR002100Transcription factor, MADS-box
SuperFamilySSF554555.76E-36296IPR002100Transcription factor, MADS-box
CDDcd002652.52E-39280No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004044.4E-28323IPR002100Transcription factor, MADS-box
PfamPF003196.0E-231057IPR002100Transcription factor, MADS-box
PRINTSPR004044.4E-282338IPR002100Transcription factor, MADS-box
PRINTSPR004044.4E-283859IPR002100Transcription factor, MADS-box
PfamPF014865.9E-2082161IPR002487Transcription factor, K-box
PROSITE profilePS5129714.11684170IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 181 aa     Download sequence    Send to blast
MGRGKIEIKR IENSSNRQVT YSKRKNGILK KAKEISVLCD AQVSLILFGA SGKMHEYISP  60
STTLIDILDR YQRASGKTLW DAKHENLSNE IDRIKKENDS MQIELRHLKG EDVTSLNYKE  120
LMALEDALET GLTGVRDKKS EVHRMIKRNG KILEDENKEL NFLLQQHLAL EGVGNMHGQW  180
I
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3kov_A5e-18289180Myocyte-specific enhancer factor 2A
3kov_B5e-18289180Myocyte-specific enhancer factor 2A
3kov_I5e-18289180Myocyte-specific enhancer factor 2A
3kov_J5e-18289180Myocyte-specific enhancer factor 2A
3p57_A5e-18289180Myocyte-specific enhancer factor 2A
3p57_B5e-18289180Myocyte-specific enhancer factor 2A
3p57_C5e-18289180Myocyte-specific enhancer factor 2A
3p57_D5e-18289180Myocyte-specific enhancer factor 2A
3p57_I5e-18289180Myocyte-specific enhancer factor 2A
3p57_J5e-18289180Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ4706310.0KJ470631.1 Medicago sativa PISTILLATA (PI) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004502537.11e-130PREDICTED: floral homeotic protein PMADS 2-like
SwissprotQ074742e-88MADS2_PETHY; Floral homeotic protein PMADS 2
TrEMBLQ5MAR01e-126Q5MAR0_PEA; MADS box transcription factor PEAM1
STRINGGLYMA04G42420.11e-122(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF43553255
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G20240.17e-76MIKC_MADS family protein